Jfgn

Description
Ychj

Please download to get full document.

View again

of 28
All materials on our website are shared by users. If you have any questions about copyright issues, please report us to resolve them. We are always happy to assist you.
Information
Category:

Documents

Publish on:

Views: 0 | Pages: 28

Extension: PPTX | Download: 0

Share
Transcript
  KOLITISKELOMPOK8 DESTYLAORANITAMEGA UNENSIM  DEFINISI ã KOLITIS ULSERATIF ADALAH PENYAKIT ULSERATIF DAN INFLAMASI BERULANG DARI LAPISAN MUKOSA KOLON DAN REKTUM. (BRUNNER & SUDDARTH, 2002, HAL 1106). ã KOLITIS ULSERATIF ADALAH PENYAKIT RADANG KOLON NONSPESIFIK YANG UMUMNYA BERLANGSUNG LAMA DISERTAI MASA REMISI DAN EKSASERBASI YANG BERGANTI-GANTI. (SYLVIA A. PRICE & LORRAINE M. WILSON, 2006, HAL, 461) ã KOLITISULSERATIFADALAHPENYAKITINFLAMASIPRIMER DARIMEMBRANMUKOSAKOLON(MONICA ESTER,2002,HAL,56).  ETIOLOGI ã ETIOLOGI KOLITIS ULSERATIF TIDAK DIKETAHUI. FAKTOR GENETIK BERPERAN DALAM ETIOLOGI KARENA TERDAPAT HUBUNGAN FAMILIAL. TERDAPAT BUKTI YANG MENDUGA BAHWA AUTOIMUNNITA BERPERAN DALAM PATOGENESIS KOLITIS ULSERATIF. ANTIBODY ANTIKOLON TELAH DITEMUKAN DALAM SERUM PENDERITA PENYAKIT INI. DALAM BIAKAN JARINGAN LIMPOSIT DARI PENDERITA KOLITIS ULSERATIF MERUSAK SEL EPITEL PADA KOLON. ã DIJELASKAN BEBERAPA TEORI MENGENAI PENYEBAB KOLITIS ULSERATIF, NAMUN TIDAK ADA YANG TERBUKTI. TEORI YANG PALING TERKENAL ADALAH TEORI REAKSI SISTEM IMUN TUBUH TERHADAP VIRUS ATAU BAKTERI YANG MENYEBABKAN TERUS BERLANGSUNGNYA PERADANGAN DALAM DINDING USUS. ã KOLITIS ULSERATIF MEMILIKI KELAINAN SISTEM IMUN, TETAPI TIDAK DIKETAHUI HAL INI MERUPAKAN PENYEBAB ATAU AKIBAT EFEK INI, KOLITIS ULSERATIF TIDAKSEBABKAN OLEH DISTRES EMOSIONAL ATAU SENSITIFITAS TERHADAP MAKANAN, TETAPI FAKTOR-FAKTOR INI MUNGKIN DAPAT MEMICU TIMBULNYA GEJALA PADA BEBERAPA ORANG. (SYLVIA A. PRICE & LORRAINE M. WILSON, 2006, HAL, 462).  MANIFESTASIKLINIK ã KEBANYAKANGEJALAKOLITISULSERATIFPADAAWALNYAADALAHBERUPABUANGAIR BESAR YANG LEBIHSERING. GEJALAYANG PALING UMUMDARIKOLITISULSERATIFADALAHSAKITPERUTDANDIAREBERDARAH. PASIENJUGADAPATMENGALAMI: ã A.ANEMIA ã B.FATIGUE/ KELELAHAN ã C.BERATBADANMENURUN ã D.HILANGNYANAFSUMAKAN ã E.HILANGNYACAIRANTUBUHDANNUTRISI ã F.LESIKULIT( ERITOMANODUSUM) ã G.LESIMATA( UVEITIS )
Similar documents
We Need Your Support
Thank you for visiting our website and your interest in our free products and services. We are nonprofit website to share and download documents. To the running of this website, we need your help to support us.

Thanks to everyone for your continued support.

No, Thanks